Loading...
Statistics

Welcome To Kechara Indonesia - English and Indonesian Site
www.kechara.or.id/
Joomla! - the dynamic portal engine and content management system
Advertisement

Kechara.or.id

Kechara.or.id report, domain review

Last update: 2016-06-06 18:56:01

Redirect checking

  • Domain isn't redirected.

Language

  • Declared Language code: En-gb
  • Detected Language code: Id

SSL checking

  • HTTPS: isn't used.

Content Report

  • Number of letters: 4487
  • Number of words: 828
  • Number of sentences: 34
  • Average words per sentences: 24
  • Number of syllables: 1684
  • Syllables in words: 1612
  • Average syllables in words: 2.03
  • Number of words in first three syllables: 252
  • Percentage of word / syllables: 30.43


Advertisement

Readability

  • Flesch–Kincaid Grade Level: 12.00
  • Flesch Reading Ease: 10.10
  • Coleman Liau Index: 12.00
  • Automated Readability Index (ARI): 12.00
  • Dale–Chall Readability: 10.00
  • SMOG Index: 12.00
  • Spache Readability: 5.00
  • Words not in Dale-Chall easy-word list: 561
  • Words not in Spache easy-word list: 338
Scores can be interpreted as shown in the table below:

Flesch–Kincaid Score | School Level

  • 90–100 | 5th grade: Very easy to read. Easily understood by an average 11-year-old student.
  • 80–89 | 6th grade: Easy to read. Conversational English for consumers.
  • 70–79 | 7th grade: Fairly easy to read.
  • 60–69 | 8th & 9th grade: Plain English. Easily understood by 13- to 15-year-old students.
  • 50–59 | 10th to 12th grade: Fairly difficult to read.
  • 30–49 | College: Difficult to read.
  • 0–30 | College graduate: Very difficult to read. Best understood by university graduates.

ARI: Score | Age

  • 1 | 5-6: Kindergarten
  • 2 | 6-7: First Grade
  • 3 | 7-8: Second Grade
  • 4 | 8-9: Third Grade
  • 5 | 9-10: Fourth Grade
  • 6 | 10-11: Fifth Grade
  • 7 | 11-12: Sixth Grade
  • 8 | 12-13: Seventh Grade
  • 9 | 13-14: Eighth Grade
  • 10 | 14-15: Ninth Grade
  • 11 | 15-16: Tenth Grade
  • 12 | 16-17: Eleventh grade
  • 13 | 17-18: Twelfth grade
  • 14 | 18-22: College

Dale–Chall Score: Easily understood by ...

  • 0.0 - 4.9: ... an average 4th-grade student or lower.
  • 5.0 – 5.9: ... an average 5th or 6th-grade student.
  • 6.0 – 6.9: ... an average 7th or 8th-grade student.
  • 7.0 – 7.9: ... an average 9th or 10th-grade student.
  • 8.0 – 8.9: ... an average 11th or 12th-grade student.
  • 9.0 – 10.0: ... an average 13th to 15th-grade (college) student.

Keywords (2 words) / counter

  • "tulku rinpoche" / 5
  • "tsem tulku" / 5
  • "kechara indonesia" / 4
  • "pesan siswa/i" / 3
  • "h.e tsem" / 3
  • "kesan dan" / 3
  • "baik untuk" / 3
  • "siswa/i yang" / 3
  • "sama lain" / 3
  • "spiritual practice" / 3

Keywords (3 words) / counter

  • "tsem tulku rinpoche" / 5
  • "dan pesan siswa/i" / 3
  • "satu sama lain" / 3
  • "pesan siswa/i yang" / 3
  • "h.e tsem tulku" / 3
  • "kesan dan pesan" / 3
  • "baik untuk berbagi" / 2
  • "yang baik untuk" / 2
  • "sesuatu yang baik" / 2
  • "untuk berbagi visi" / 2

Important Meta Datas

  • Meta Title: Welcome To Kechara Indonesia - English and Indonesian Site
  • Meta description: Joomla! - the dynamic portal engine and content management system
  • Meta Keywords: joomla, Joomla

Other Meta datas:

  • Name:
    Content: text/html; charset=utf-8
  • Name: robots
    Content: index, follow
  • Name: keywords
    Content: joomla, Joomla
  • Name: description
    Content: Joomla! - the dynamic portal engine and content management system
  • Name: generator
    Content: Joomla! 1.5 - Open Source Content Management

Html Elements

  • <a> : 59
  • <td> : 49
  • <li> : 46
  • <div> : 24
  • <tr> : 20
  • <img> : 16
  • <p> : 12
  • <ul> : 11
  • <span> : 10
  • <br> : 10
  • <h2> : 8
  • <link> : 8
  • <table> : 6
  • <script> : 6
  • <meta> : 5
  • <h3> : 5
  • <em> : 5
  • <blockquote> : 2
  • <html> : 1
  • <b> : 1
  • <body> : 1
  • <tbody> : 1
  • <head> : 1
  • <title> : 1

Html Classes

  • "latestnews" : 92
  • "parent" : 7
  • "bs_contentdiv" : 4
  • "biru2" : 4
  • "biru1" : 4
  • "kotak" : 2
  • "bqend" : 2
  • "bs_opacitylayer" : 1
  • "world" : 1
  • "blog" : 1
  • "contentpaneopen" : 1
  • "mostread" : 1
  • "article_separator" : 1
  • "mod_bannerslider" : 1
  • "item30" : 1
  • "item28" : 1
  • "menu" : 1
  • "nav" : 1
  • "item101" : 1
  • "item135" : 1
  • "clear" : 1
  • "item119" : 1
  • "item103" : 1
  • "item97" : 1
  • "wrapper" : 1

Links

We found a total of 59 different links.
External dofollow links:
10
Internal dofollow links:
49

External dofollow

Number of External dofollow links: 10

  • Href: http://www.lamatsongkhapa.com
    Count: 1
  • Href: http://www.lamatsongkhapa.com/index.php?option=com_content&view=article&id=273&Itemid=124
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=article&id=67&Itemid=28
    Title: Lama Tsongkhapa
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=category&layout=blog&id=88&Itemid=133
    Title: Tsem Tulku Rinpoche - Teachings
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=category&layout=blog&id=89&Itemid=134
    Title: Tsem Tulku Rinpoche - From Rinpoche's Blog
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=category&layout=blog&id=72&Itemid=101
    Title: Student Sponsorship Program
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=category&layout=blog&id=90&Itemid=135
    Title: Soup Kitchen
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=category&layout=defaultcatalog&id=83&Itemid=121
    Title: Miscellanous - Delicious Vegetarian Recipes
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=section&layout=blog&id=9&Itemid=111
    Title: Miscellanous - General Prayers
    Count: 1
  • Href: http://lamatsongkhapa.com/index.php?option=com_content&view=section&layout=blog&id=10&Itemid=103
    Title: Dedications
    Count: 1

Internal dofollow

Number of Internal dofollow links: 49

  • Href: /index.php?option=com_content&view=article&id=67&Itemid=28
    Title: Lama Tsongkhapa
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=60&Itemid=30
    Title: H.E. Tsem Tulku Rinpoche
    Count: 1
  • Href: /index.php?option=com_content&view=category&layout=blog&id=72&Itemid=101
    Title: Student Sponsorship Program
    Count: 1
  • Href: /index.php?option=com_content&view=category&layout=blog&id=90&Itemid=135
    Title: Soup Kitchen
    Count: 1
  • Href: /index.php?option=com_content&view=section&id=15&Itemid=97
    Title: Miscellaneous
    Count: 1
  • Href: /index.php?option=com_content&view=section&layout=blog&id=10&Itemid=103
    Title: Dedications
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=51&Itemid=119
    Title: About Us
    Count: 1
  • Href: /index.php?option=com_banners&task=click&bid=9
    Count: 1
  • Href: /index.php?option=com_banners&task=click&bid=10
    Count: 1
  • Href: /index.php?option=com_banners&task=click&bid=11
    Count: 1
  • Href: /index.php?option=com_banners&task=click&bid=12
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=317:interviewdenganpemimpintertinggitradisigelugpabuddhatibet&catid=65:prayersresources&Itemid=18
    Title: Interview dengan Yang Mulia Gaden Tripa ke-101 Lungrik Namgyal
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=298:jetsongkhapaqtigaaspekutamadarijalanq&catid=65:prayersresources&Itemid=18
    Title: Je Tsongkhapa “Tiga Aspek Utama dari Jalan”
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=269:tigajalanutama&catid=65:prayersresources&Itemid=18
    Title: Tiga jalan utama
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=227:transkrip-ajaran-guru-yoga&catid=65:prayersresources&Itemid=18
    Title: TRANSKRIP - Ajaran Guru Yoga
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=214:transkrip-penjelasan-mengenai-tsongkhapa&catid=65:prayersresources&Itemid=18
    Title: Transkrip: Penjelasan mengenai Tsongkhapa
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=213:10-steps-to-happiness&catid=93:contemplation&Itemid=141
    Title: 10 Steps to Happiness
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=211:hidup-dengan-etika-memberi-dan-menerima&catid=93:contemplation&Itemid=141
    Title: Hidup Dengan Etika: Memberi dan Menerima
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=201:menghindariperbuatanburukreinkarnasidankarma&catid=93:contemplation&Itemid=141
    Title: Menghindari Perbuatan Buruk, Reinkarnasi dan Karma
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=200:pikiran&catid=93:contemplation&Itemid=141
    Title: Pikiran
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=197:bekerjadanbermainmenjadisatu&catid=93:contemplation&Itemid=141
    Title: Bekerja dan Bermain Menjadi Satu
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=362:dorjeshugdenterbesardidunia&catid=96:worthywords&Itemid=140
    Title: Dorje Shugden Terbesar di Dunia
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=358:sesuatuyangbaikuntukberbagi&catid=96:worthywords&Itemid=140
    Title: Sesuatu yang baik untuk berbagi!
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=357:visiuntukmasadepanjakarta&catid=96:worthywords&Itemid=140
    Title: Visi Untuk Masa Depan Jakarta
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=356:sebuahdoasinkatuntukdorjeshugden&catid=96:worthywords&Itemid=140
    Title: Sebuah Doa Singkat untuk Dorje Shugden
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=354:dorjeshugdenmengalauilmuhitamdanmakhlukhalus&catid=96:worthywords&Itemid=140
    Title: Dorje Shugden Trakze untuk Menghalau Gangguan Ilmu Hitam & Makhluk Halus
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=363:perayaankelulusanprogrambeasiswa2015&catid=79:ssswhattheysay&Itemid=123
    Title: Perayaan kelulusan peserta program beasiswa Yayasan Kechara Indonesia – 17 Mei 2015
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=361:kesandanpesansiswayangmenerimabantuan2015&catid=79:ssswhattheysay&Itemid=123
    Title: Kesan dan Pesan Siswa/i yang menerima dana bantuan tahun 2015
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=348:kesandanpesan2014&catid=79:ssswhattheysay&Itemid=123
    Title: Kesan dan Pesan Siswa/i yang menerima dana bantuan tahun 2014
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=341:kesanpesansiswai2014&catid=79:ssswhattheysay&Itemid=123
    Title: Kesan Dan Pesan Siswa/i Yang Lulus Juni 2014
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=314:perkembangananakasuhyglulus&catid=79:ssswhattheysay&Itemid=123
    Title: Perkembangan anak asuh yang sudah lulus
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=364:tantanganyki2015gunungagungbali&catid=92:soupcurrentupdates&Itemid=137
    Title: Tantangan Kechara Indonesia 2015 – Gunung Agung, Bali
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=360:sesuatuyangbaikuntukberbagi&catid=92:soupcurrentupdates&Itemid=137
    Title: Sesuatu yang baik untuk berbagi!
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=359:visiuntukmasadepanjkt&catid=92:soupcurrentupdates&Itemid=137
    Title: Visi Untuk Masa Depan Jakarta
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=347:aktivitasagustusnopember&catid=92:soupcurrentupdates&Itemid=137
    Title: Aktivitas Kechara Indonesia Bulan Agustus-Nopember 2014
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=340:aktivitaskecharaapril-juli&catid=92:soupcurrentupdates&Itemid=137
    Title: Aktivitas Kechara Indonesia bulan April-Juli 2014
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=177:nasitim&catid=83:veganhumanrecipes&Itemid=121
    Title: Nasi Tim
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=176:jamurgoreng&catid=83:veganhumanrecipes&Itemid=121
    Title: Jamur Goreng
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=138:sambelgorengkentang&catid=83:veganhumanrecipes&Itemid=121
    Title: Sambel Goreng Kentang
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=137:nasipanggang&catid=83:veganhumanrecipes&Itemid=121
    Title: Nasi Panggang Jamur
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=130:pasteltutup&catid=83:veganhumanrecipes&Itemid=121
    Title: Pastel Tutup
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=296:pengabdianpadaguruolehlamazoparinpoche&catid=76:otherprayers&Itemid=118
    Title: Pengabdian pada Guru oleh Lama Zopa Rinpoche
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=295:berbagaiaspektantraolehyangmuliakyabjetrijangrinpoche&catid=76:otherprayers&Itemid=118
    Title: Berbagai Aspek Tantra oleh Yang Mulia Kyabje Trijang Rinpoche
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=294:duakebenaranolehdenmaloncorinpoche&catid=76:otherprayers&Itemid=118
    Title: Dua Kebenaran oleh Denma Lochö Rinpoche
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=293:rahasiapikiranadalanyamatakadansangmurka&catid=76:otherprayers&Itemid=118
    Title: Rahasia Pikiran adalah Yamantaka dan Sang Murka
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=292:sejarahdanpentingnyadharmapala&catid=76:otherprayers&Itemid=118
    Title: Sejarah dan Pentingnya Dharmapala
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=53:persembahanumum&catid=35:generaldedications&Itemid=104
    Title: Persembahan Umum untuk Berbagai Kesempatan
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=52:yontenshigyurma&catid=36:yontenshigyurma&Itemid=105
    Title: Yonten Shigyurma
    Count: 1
  • Href: /index.php?option=com_content&view=article&id=54:shantidevasbodhicharyavatara&catid=37:shantidevabodhicharyavatara&Itemid=106
    Title: Shantideva's Bodhicharyavatara
    Count: 1